Doodle

1,830 Coloring Pages of Pollinator

plantsflowerspollinator-friendlyperennialgardensanimalswildflowermeadowinsectstropical
Delphinium Trolliifolium or Columbian Larkspur from Larkspur
Orchid Lycaste Aromatica from Orchid
Epigaea Repens or Mayflower or Trailing Arbutus from Leaves
Chrysanthemum 1 from Perennial
Black Elderberry from Elderberry
Iris Flower Blossom from Iris
Iris Motif from Iris
Disa Kewensis Orchid from Orchid
Double Delight Hybrid Tea Rose from Roses
Larkspur Flower from Larkspur
Black Orchid from Orchid
Common Buttercup Flower from Buttercup
Hemerocallis Spp or Day Lily from Perennial
Anethum graveolens or Dill from Herb
Caterpillar and Buttefly from Caterpillar
Rhododendron Calendulaceum or Flame Azalea from Azalea
Flower Poppy from Red
Ipomoea Tuberosa Hawaiian Woodrose from Roses
Europeana Floribunda Rose from Roses
Orchids from Orchid
Butterfly from Cartoon animals viii coloring book
Steampunk Bee from Steampunk animals coloring book
Cosmos Scabiosoides from Cosmos
Daffodil from Daffodil
Apple Blossom Branch from Apple tree
Bumblebee from Woodland animals
Bee from Cartoon animals v coloring book
Fireweed or Rosebay Willowherb from Celebrating wildflowers coloring book
Annual Hibiscus (Abelmoschus Moschatus) from Hawaii flower
Swallow Tail Hummingbird from Hummingbirds
American Twinflower from Celebrating wildflowers coloring book
Ladybug from Cartoon animals viii coloring book
Realistic Ruby Throated Hummingbird from Hummingbirds
Ladybug from Cartoon animals v coloring book
Bumblebee from Bumblebee
Realistic Sunflowers from Sunflower
Daisy from Simple objects iv coloring book
Bumblebee from Simple objects coloring book
Bee from Cartoon animals viii coloring book
Common Fruit Bats from Realistic animals coloring book
Heliconia Indica from Heliconia
Black Raspberry from Celebrating wildflowers coloring book
Chinese Peony from Flowers
Bug from Animals
Cherokee Rose from Roses
Hibiscus from Realistic flowers
Hibiscus Flower from Hawaii flower
Spring Crocus from Crocus
Butterfly from Cartoon animals vii coloring book
Hummingbird from Cartoon animals ii coloring book
Ladybug from Cartoon animals coloring book
Butterfly from Cartoon animals coloring book
Masdevallia Coccinea Orchid from Orchid
Grasshopper on the Flower from Grasshoppers
Saskatoon from Serviceberry
Renanthera Imschootiana Orchid from Orchid
Hyacinth Flower from Hyacinthus
Rabbit Smelling Tulip from Grass
Bluebell Bellflower from Bellflower
Ranunculus Acris from Buttercup
Chinese Bellflower (Platycodon Grandiflorus) from Bellflower
Cornflower, Blue Bottle from Cornflowers
Heliconia Psittacorum from Heliconia
Scarlet Carnation from Carnation
Aster or Star Plant from Asters
Cute Butterfly Flies over the Swamp from Cute butterflies coloring book
Tall Mountain Bluebells from Celebrating wildflowers coloring book
Butterfly Flies On A Flower from Flowers
Burke's Larkspur from Celebrating wildflowers coloring book
Common Evening Primrose or Evening Star from Primrose
Tropical Vanda Tricolor Orchid from Orchid
Aster 1 from Asters
Sophronitis Cernua Orchid from Orchid
Grasshopper on Flower from Grasshoppers
Grasshopper in Garden from Grasshoppers
ʻIʻiwi - Hawaiian Honeycreeper from Hawaii
Cornflower from Cornflowers
Sundowner Rosa Grandiflora from Roses
Schlumbergera Bloom from Cactus
Aquilegia Truncata Red Columbine from Columbine
Cochlospermum Vitifolium or Buttercup Tree from Buttercup
Viola Adunca or Pale Mountain Violet from Violet
Cirsium Vulgare or Bull Thistle from Thistle
Daffodil Flowers from Daffodil
Clarkia Amoena Farewell to Spring from Godetia
Dianthus Caryophyllus Clove Pink Carnation from Carnation
Oriental poppy from Perennial
Wildflower from Plants ii coloring book
Bug from Cartoon animals coloring book
Western Blue Flax from Celebrating wildflowers coloring book
Cherry Jam Jar from Cherry
Horse Chestnut from Chestnut
Anemone flower from Anemone
Marigold from Beautiful flowers coloring book
Nettle-leaved Bellflower from Bellflower
Honey Bee from Woodland animals
Watering Can with Flowers from Watering can
Meadow Buttercup, Ranunculus Acris from Buttercup
Butterflies and Flowers on a Meadow from Summer
Giant Red Indian Paintbrush from Celebrating wildflowers coloring book
201 - 300 of 1,830 Next page
/ 19